|
|
cysteine protease Results
More cysteine protease Results:
FASTA aligned Sequences Annotated by Structure
... Molecular model of the cathepsin b-like cysteine protease ... 1csb(A ... d Crystal structure of a cysteine protease proform 1atk ...
http://www.biochem.ucl.ac.uk/cgi-bin/sas/process_form.cgi?op_type=allPDB%26database=allPDB%26sprotcode=CATB_HUMAN%26omim_code=116810
CED-3 IS A CYSTEINE PROTEASE THAT CONTROLS PROGRAMMED CELL DEATH
Early 1995 International Worm Meeting abstract 022. CED-3 IS A CYSTEINE PROTEASE THAT CONTROLS PROGRAMMED CELL DEATH. Ding Xue, Bob Horvitz. HHMI, Dept. ... interleukin-1B converting enzyme (ICE), a cysteine protease that has been implicated in programmed cell ... These findings indicate that a cysteine protease family may be involved in ...
http://bargmann.ucsf.edu/pages/iwm/wm95e022.htm
Pfam: domain structure of proteins in the Peptidase_C1 Seed alignment
... B-like cysteine proteinase 3 precursor (EC 3.4.22.-) ( Cysteine protease related 3). Cathepsin B-like cyste ... O15555 O15555 Cysteine protease. Cysteine protease. [ 301 residues ...
http://pfam.wustl.edu/cgi-bin/getdomainview?name=Peptidase_C1
A cysteine protease encoded by the baculovirus Bombyx mori nuclear polyhedrosis virus.
A cysteine protease encoded by the baculovirus Bombyx mori nuclear polyhedrosis virus. Sequence analysis of the BamHI F fragment of the genome of Bombyx mori nuclear polyhedrosis virus (BmNPV) ...
http://rdre1.yahoo.com/click?u=http://www.pubmedcentral.gov/articlerender.fcgi%253Fartid%253D237082%26y=027E70588BDCA9CD%26i=487%26c=9107%26q=02%255ESSHPM%255BL7%257Cflkzvqz%253Fompkz~lz6%26e=utf-8%26r=18%26d=nrm-en-us%26n=EB5K5H0LR6H405VU%26s=12%26t=%26m=40A2F0F9%26x=018255A98A2FFB53
Untitled Document
please be patient, may take a while to load! BLASTP 2.0.11 [Jan-20-2000] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
http://cubic.bioc.columbia.edu/cgi-bin/var/eva/query_dbbio.pl?pdbid=1fwo_A%26format=blastpgp_ascii
Cysteine proteases in L. mexicana
... the pro-domain of a cysteine protease is. essential for activation of ... cantly from cysteine protease. trafficking in mammalian cells.Key words: Cysteine protease, Protease, Cathepsin L ...
http://intl-jcs.biologists.org/cgi/reprint/113/22/4035.pdf
AmiGO : GO:0004869 details
... Get this data as a GO flat file. cysteine protease inhibitor activity ... GO:0004869 : cysteine protease inhibitor activity (33) ...
http://www.godatabase.org/cgi-bin/go.cgi?view=details%26depth=1%26query=GO%253A0004869
Effect of Group A Streptococcal Cysteine Protease on Invasion of Epithelial Cells
Effect of Group A Streptococcal Cysteine Protease on Invasion of Epithelial Cells Cysteine protease of group A streptococci (GAS) is considered an important virulence factor. However, its role in ...
http://rdre1.yahoo.com/click?u=http://www.pubmedcentral.gov/articlerender.fcgi%253Fartid%253D108075%26y=028EB4C360E6D3BB%26i=487%26c=9107%26q=02%255ESSHPM%255BL7%257Cflkzvqz%253Fompkz~lz6%26e=utf-8%26r=12%26d=nrm-en-us%26n=EB5K5H0LR6H405VU%26s=12%26t=%26m=40A2F0F9%26x=01BEBF4BFC954580
FASTA aligned Sequences Annotated by Structure
... dhsleaqwtkwkamhnrlygm-neegwrravweknmkmi Crystal structure of a cysteine protease proform 1cs8(A ... Crystal structure of the cysteine protease human cathepsin ... 1au0 ...
http://www.biochem.ucl.ac.uk/cgi-bin/sas/process_form.cgi?op_type=allPDB%26database=allPDB%26sprotcode=CATS_HUMAN%26omim_code=116845
IAI -- Lukomski et al. 67 (4): 1779
... The role of an extracellular cysteine protease encoded by the speB gene in group A Streptococcus ... serotype M3 strain or a cysteine protease-inactivatedisogenic derivative grown to ...
http://iai.asm.org/cgi/content/full/67/4/1779
IAI -- Gubba et al. 68 (6): 3716
... pyogenes expresses a highly conserved extracellular cysteine protease that is a virulence factor for invasive ... used to create a mutant cysteine protease with the His340Ala amino acid ...
http://iai.asm.org/cgi/content/full/68/6/3716
AmiGO : GO:0008234 details
GOst Search. Get this GO term as RDF XML. Get this data as a GO flat file. cysteine-type peptidase activity. Accession:GO:0008234. Synonyms: cysteine protease. GO:0004220 ... PF02_0069. Pfalciparum. ISS. cysteine protease, putative. PF02_0070 ...
http://www.godatabase.org/cgi-bin/go.cgi?view=details%26depth=1%26query=GO%253A0008234
Novel cysteine protease inhibitors - Publications
Other departments on ILM. Choose department.......... Abrahamson Home. Abstract. Publications. Contact us. Group. Publications about protease inhibitors. 2004. Wassélius J, Håkansson K, Abrahamson M, Ehinger B. ... of chagasin, a tight-binding cysteine protease inhibitor in Trypanosoma cruzi ... Peptidyl diazomethylketones as cysteine protease inhibitors structurally based upon the inhibitory ...
http://www.klinkem.lu.se/E/abrahamson/pub-cys.html
InterPro: Cysteine protease inhibitor
Site search ? InterPro. InterPro home. Text Search. Sequence Search. Databases. Documentation. FTP site. Protein of the month. Search: Search Entries. Find protein matches. IPR. InterPro. Cysteine protease inhibitor [?] = help. Name [?]
http://www.ebi.ac.uk/interpro/IEntry?ac=IPR000010
Cysteine Protease Work
Inhibition of Cysteine Proteases. Cysteine proteases constitute an important class of enzymes involved in the formation and hydrolysis of the peptide amide bond. ... The basic features of the cysteine protease mechanism of action involve attack of the ... Trypanosoma cruzi, has a major cysteine protease called cruzain that was discovered ...
http://www.umich.edu/~roushlab/cysteine_protease_work.htm
Cysteine Protease Inhibitor Is Specifically Expressed in Pre- and Early-Vitellogenic Oocytes
... AND DEVELOPMENT 60:312±318 (2001)Cysteine Protease Inhibitor Is SpecificallyExpressed in Pre- and ... to a newfamily of cysteine protease inhibitors characterized bythe presence ...
http://www.nd.edu/~srobert4/goetz/ocpi.pdf
European Journal of Biochemistry -- Spinella et al. 266 (1): 170
... A novel cysteineprotease from parasite extracts was purified 15-fold by a procedureincluding concanavalin A ... The 60-kDa cysteineprotease translocated to the amoebic surface upon the ...
http://www.ejbiochem.org/cgi/content/full/266/1/170
JBC -- Shenai et al. 275 (37): 29000
... for parasite protein synthesis. Cysteine proteaseinhibitors block hemoglobin degradation, indicating that a cysteineprotease plays a key role in ...
http://www.jbc.org/cgi/content/full/275/37/29000
Novel cysteine protease inhibitors
... inhibitors of human, parasitic and bacterial cysteine proteases. Thereby, basal information of ... between different enzyme families, most protease inhibitors can only efficiently bind ...
http://www.klinkem.lu.se/E/abrahamson
Literature for peptidase C10.001
... of superantigen-induced responses by streptococcal cysteine protease. J Infect Dis187 ... influences maturation of the Streptococcus pyogenes cysteine protease. J Bacteriol185, 3661 ...
http://merops.sanger.ac.uk/lit/c10p001_lit.htm
|
|
|
